PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc01621.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 336aa    MW: 37095.4 Da    PI: 6.934
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc01621.1.g00010.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS338.71e-1031533174374
                          GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgs 154
                                    +e +aa++ f +++P+l+++  +aNq +lea+e e+ vH++D++    +QW+ Ll+ La+Rpegpp+lR+T+v++    +
  Zjn_sc01621.1.g00010.1.am.mk  15 PAELVAARRHFLDLCPFLRLAGAAANQSVLEAMEAEKIVHVVDLGGADATQWLELLHLLAARPEGPPHLRLTAVSE----H 91 
                                   567889999*******************************************************************....9 PP

                          GRAS 155 keeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll..................... 214
                                   k+ l +t+  L+k Ae+l+vpf+fn+ v++rl++l++e+Lrvk+gEala+ ++lqlh ll                     
  Zjn_sc01621.1.g00010.1.am.mk  92 KDVLTQTAIALSKEAERLDVPFQFNP-VVTRLDALDVESLRVKTGEALAITSSLQLHCLLasdddtaaggkdkkenrrspe 171
                                   **************************.79************************************************9975 PP

                          GRAS 215 desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                                   +   +++s+ d++L+++++lsPkv+vv+eqea+hn++ + erf+eal+yy+alfd+le+ ++r s er+ vEr +lg+ei+
  Zjn_sc01621.1.g00010.1.am.mk 172 SGLSPSTSRADAFLSALWGLSPKVMVVTEQEASHNAPALTERFVEALNYYAALFDCLEVVAARGSVERARVERWMLGEEIK 252
                                   22233444789********************************************************************** PP

                          GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   n+vac gaerrerhe+l +W +r+e aGF+ vpls++a  qa++  +  + dg++v ee+gs++l+W+dr+++svSaWr
  Zjn_sc01621.1.g00010.1.am.mk 253 NIVACDGAERRERHERLDRWARRMEGAGFGRVPLSYYALLQARRAAQGLGCDGFKVREEKGSFFLCWQDRAIFSVSAWR 331
                                   ******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.7721311IPR005202Transcription factor GRAS
PfamPF035143.6E-10115331IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
GLCRALLLPR AAPTPAELVA ARRHFLDLCP FLRLAGAAAN QSVLEAMEAE KIVHVVDLGG  60
ADATQWLELL HLLAARPEGP PHLRLTAVSE HKDVLTQTAI ALSKEAERLD VPFQFNPVVT  120
RLDALDVESL RVKTGEALAI TSSLQLHCLL ASDDDTAAGG KDKKENRRSP ESGLSPSTSR  180
ADAFLSALWG LSPKVMVVTE QEASHNAPAL TERFVEALNY YAALFDCLEV VAARGSVERA  240
RVERWMLGEE IKNIVACDGA ERRERHERLD RWARRMEGAG FGRVPLSYYA LLQARRAAQG  300
LGCDGFKVRE EKGSFFLCWQ DRAIFSVSAW RGRRFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-441733175375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2875400.0AK287540.1 Oryza sativa Japonica Group cDNA, clone: J065011K01, full insert sequence.
GenBankAP0032590.0AP003259.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0466H10.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456925.10.0hypothetical protein SORBIDRAFT_03g045660
SwissprotQ9LPR81e-129SCL3_ARATH; Scarecrow-like protein 3
TrEMBLC5XHT90.0C5XHT9_SORBI; Putative uncharacterized protein Sb03g045660
STRINGSb03g045660.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-113scarecrow-like 3